AibGenesis™ Mouse Anti-HTR6 Antibody (CBMOAB-44939FYA)


Cat: CBMOAB-44939FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44939FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44939FYA 100 µg
CBMOAB-80162FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80162FYA 100 µg
MO-AB-02365Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02365Y 100 µg
MO-AB-57052W Monoclonal Marmoset WB, ELISA MO57052W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset, Zebrafish (Danio rerio)
CloneMO44939FYA
SpecificityThis antibody binds to Rhesus HTR6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the seven-transmembrane G protein-coupled receptor family of proteins. The encoded protein couples with the Gs alpha subunit and stimulates adenylate cyclase to activate the cyclic AMP-dependent signaling pathway. This receptor is thought to regulate cholinergic neuronal transmission in the brain. Several antidepressants and antipsychotic drugs have a high affinity for this receptor. (From NCBI)
Product OverviewMouse Anti-Rhesus HTR6 Antibody is a mouse antibody against HTR6. It can be used for HTR6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5-hydroxytryptamine receptor 6; HTR6
UniProt IDH9FHJ7
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: VPGQCRLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVPRTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPGLFDALTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPWERQASLASPSLRTSHSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry