Mouse Anti-HVCN1 Antibody (CBMOAB-44954FYA)


Cat: CBMOAB-44954FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44954FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44954FYA 100 µg
CBMOAB-80185FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80185FYA 100 µg
MO-AB-02373Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02373Y 100 µg
MO-AB-14213W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14213W 100 µg
MO-AB-57063W Monoclonal Marmoset WB, ELISA MO57063W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO44954FYA
SpecificityThis antibody binds to Rhesus HVCN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus HVCN1 Antibody is a mouse antibody against HVCN1. It can be used for HVCN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHVCN1
UniProt IDF6TBN6
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: VFWDQAAAVTRRAKVAPAERMSKFLKHFTVVGDDYHAWNINYKKWENEEDEEEEEQPPPTPASGEEGRVAGPDAAPAPGPAPRAPLDFRGTLRKLFSSHRFQVIIICLVVLDTLLVLAELILDLRIIQPDKKNYAAMIFHYMSIAILALFMMEITFKLFVFRLEFFHHKFEILDAVVVVVSFVLDVVLLFQEHEFEALGLLILLRLWRVARIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry