Mouse Anti-I-mf Antibody (MO-AB-14166R)


Cat: MO-AB-14166R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14166R Monoclonal Cattle (Bos taurus), Sheep (Ovis aries) WB, ELISA MO14166R 100 µg
MO-AB-15803Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15803Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Sheep (Ovis aries)
CloneMO14166R
SpecificityThis antibody binds to Cattle I-mf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle I-mf Antibody is a mouse antibody against I-mf. It can be used for I-mf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInhibitor of MyoD family-form a, Fragment; I-mf
UniProt IDQ9TTZ7
Protein RefseqThe length of the protein is 170 amino acids long.
The sequence is show below: DSIDLDVPIEAVTCQPQGNPLDCTPLVANGSGHPSELGSARRTGNGALGGPKAHRKLQTHPSLASQGSKKSKGSTKSAASQIPLQAQEDCCVHCILSCLFCEFLTLCNLVLDCATCGSCSSEDSCLCCCCCGSGECADCGLPCDLDCGILDACCESADCLEICMECCGLC.
For Research Use Only | Not For Clinical Use.
Online Inquiry