Mouse Anti-ICAM3 Antibody (MO-AB-26450R)


Cat: MO-AB-26450R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-26450R Monoclonal Pig (Sus scrofa), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO26450R 100 µg
CBMOAB-45005FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO45005FYA 100 µg
MO-AB-14085W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14085W 100 µg
MO-AB-13929R Monoclonal Cattle (Bos taurus) WB, ELISA MO13929R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO26450R
SpecificityThis antibody binds to Pig ICAM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewThis product is a mouse antibody against ICAM3. It can be used for ICAM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntracellular adhesion molecule 3, Fragment; ICAM3
UniProt IDQ684M8
Protein RefseqThe length of the protein is 353 amino acids long.
The sequence is show below: MATMVPSWLPSGAYWIFLISLLLVACLLPPGAQGQEFQMRVELQPPAVLPGESVLVNCSTDCLHAKLISVETYLLWEPVGSGRGWAAFQLNNVTGDTQFFCFGLCDDFQIVRSSNITIYRFPERVELAPLPPWHPLDKPLLLSCLLSGGAPRAHLTVALFKGEEELGRQPAAKGEPTEVTVTVSASRDDHGANFSCRTELDLRSQGLGLFQNSSAPRKLQTFAMPVTPPRLVVPQFSEVETLWPVECTLDGIFPASEAQVQLALGNQSLNPAVVSHGDRLTATATAKAEQKGAHEIVCNVTLGGKTLETRENVTIQSFQGPNLTLSEHNVNEGTIVIVTCTAGPQVLFTLVGI.
See other products for " ICAM3 "
For Research Use Only | Not For Clinical Use.
Online Inquiry