Mouse Anti-ICAM4 Antibody (CBMOAB-45010FYA)


Cat: CBMOAB-45010FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45010FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO45010FYA 100 µg
MO-AB-18360W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18360W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO45010FYA
SpecificityThis antibody binds to Rhesus ICAM4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus ICAM4 Antibody is a mouse antibody against ICAM4. It can be used for ICAM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesICAM4
UniProt IDF7HJJ6
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MGSLFPLSLLLFLAAAYPGVGCALGRRIKRAQGPKGSPLAPSGTSVPFWVRMSPEFVAVPPGRSVWLNCSNSCPQPQNSSLRTRLRQGKTLRGPGWVYYQLLDVRAWSSQAHCLVTCAGKTRWATTRITAYKPPHSVILEPPVLKGRQYTLRCHVTHVFPVGYLVVTLRLGGRVIYSESLERYTHQDLANVTLTYEFPAGPRDFWQPLICHTRLNLEGLVVRNSSAPVTLMLAWSPAPTALASVSIAALVGILLAVGSVYLYKCLPMKSQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry