Mouse Anti-ICE2 Antibody (MO-AB-13930R)


Cat: MO-AB-13930R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13930R Monoclonal Cattle (Bos taurus), A. thaliana (Arabidopsis thaliana), Marmoset WB, ELISA MO13930R 100 µg
CBMOAB-35121FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO35121FC 100 µg
MO-AB-57093W Monoclonal Marmoset WB, ELISA MO57093W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), A. thaliana (Arabidopsis thaliana), Marmoset
CloneMO13930R
SpecificityThis antibody binds to Cattle ICE2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein component of the little elongation complex (LEC), which plays a role in small nuclear RNA (snRNA) transcription. The LEC regulates snRNA transcription by enhancing both RNA Polymerase II occupancy and transcriptional elongation. The encoded protein and other LEC components have been shown to localize to Cajal bodies, which are sites of ribonucleoprotein (RNP) complex assembly. Pseudogenes of this gene have been identified on chromosomes 3 and 4.
Product OverviewMouse Anti-Cattle ICE2 Antibody is a mouse antibody against ICE2. It can be used for ICE2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLittle elongation complex subunit 2; ICE2
UniProt IDF1N6M1
Protein RefseqThe length of the protein is 981 amino acids long.
The sequence is show below: MTSMMAMGEPRLNWDVSPKNGLKTFFSRENYKDQSMAPSLKELCILSSRRIGENLNASAGSVENEPTVNSAAQAKEKVKTTVGMVLLPKPRVPYPRFSRFSQREQRNYVDLLVKYAKVPPNSKTVGINKNDYLQYLEMKKHVNEEVTEFLKFLQNSAKKCAQDYNMLSDDACLVTEQILKACIEQVKKYPEFYTLHEVTSLMGFFPFRIEMGFKLEKTLLALGSVKYVKTVFPSMPAKLQLSKDTIPAIETPEQI.
For Research Use Only | Not For Clinical Use.
Online Inquiry