Mouse Anti-IER5L Antibody (CBMOAB-45040FYA)


Cat: CBMOAB-45040FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45040FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO45040FYA 100 µg
CBMOAB-80273FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80273FYA 100 µg
MO-AB-57122W Monoclonal Marmoset WB, ELISA MO57122W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO45040FYA
SpecificityThis antibody binds to Rhesus IER5L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IER5L Antibody is a mouse antibody against IER5L. It can be used for IER5L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesImmediate early response gene 5-like protein; IER5L
UniProt IDH9F689
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: PAPASSPGFYRGAYPAPSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLSSAAGCKRKYYPGQEEEEDDEEDAGELGAEPPGGAPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVAF.
For Research Use Only | Not For Clinical Use.
Online Inquiry