AibGenesis™ Mouse Anti-IFFO2 Antibody (CBMOAB-45045FYA)


Cat: CBMOAB-45045FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45045FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris) WB, ELISA MO45045FYA 100 µg
MO-AB-03772W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03772W 100 µg
MO-AB-31227W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31227W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris)
CloneMO45045FYA
SpecificityThis antibody binds to Rhesus IFFO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IFFO2 Antibody is a mouse antibody against IFFO2. It can be used for IFFO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntermediate filament family orphan 2; IFFO2
UniProt IDH9FA17
Protein RefseqThe length of the protein is 260 amino acids long.
The sequence is show below: IERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry