Mouse Anti-IFI30 Antibody (CBMOAB-45050FYA)


Cat: CBMOAB-45050FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45050FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45050FYA 100 µg
CBMOAB-80283FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80283FYA 100 µg
MO-AB-04440H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04440C 100 µg
MO-AB-13959R Monoclonal Cattle (Bos taurus) WB, ELISA MO13959R 100 µg
MO-AB-25461W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25461W 100 µg
MO-AB-26429H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26429C 100 µg
MO-AB-41855W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41855W 100 µg
MO-AB-57130W Monoclonal Marmoset WB, ELISA MO57130W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45050FYA
SpecificityThis antibody binds to Rhesus IFI30.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing.
Product OverviewMouse Anti-Rhesus IFI30 Antibody is a mouse antibody against IFI30. It can be used for IFI30 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIFI30
UniProt IDF6Z5T3
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: PSRHTFAPAMSLSPLLLFLPPLLLLLDDPTAAVQASPLQTLDIFGNGPPVNYKMGNLYLRGPVKKSNAPLVNVTLYYEALCGGCRAFLVRELFPTWLMVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKLNKVEACLLDMLDMDLAFLTIVCMEEFDDMEKSLPLCLQLYAPGLSPDTIMECATGDRGMQLMHANAQRTDALQPPHEYVPWVTINGKPLEDQSQLLTLVCQLYQGEKPDICPPSTHSLRGVCFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry