Mouse Anti-IFITM1 Antibody (CBMOAB-45069FYA)


Cat: CBMOAB-45069FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45069FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO45069FYA 100 µg
MO-AB-13967R Monoclonal Cattle (Bos taurus) WB, ELISA MO13967R 100 µg
MO-AB-26432H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26432C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO45069FYA
SpecificityThis antibody binds to Rhesus IFITM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IFITM1 Antibody is a mouse antibody against IFITM1. It can be used for IFITM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIFITM1
UniProt IDF6ZD87
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MHKEEHEVSVLGAPHSTILPRSTMINIQSETSVPDHIVWSLFNTIFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNISALIVGILMTIGFILLLVYGSVAIYHVMLQIVQEKQRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry