Mouse Anti-IFITM3 Antibody (CBMOAB-45072FYA)


Cat: CBMOAB-45072FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45072FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO45072FYA 100 µg
MO-AB-02765Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02765Y 100 µg
MO-AB-04443H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04443C 100 µg
MO-AB-26435H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26435C 100 µg
MO-AB-26484R Monoclonal Pig (Sus scrofa) WB, ELISA MO26484R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO45072FYA
SpecificityThis antibody binds to Rhesus IFITM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. Another variant encoding an N-terminally truncated isoform has been reported, but the full-length nature of this variant has not been determined.
Product OverviewMouse Anti-Rhesus IFITM3 Antibody is a mouse antibody against IFITM3. It can be used for IFITM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIFITM3
UniProt IDF6ZD94
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MNHTVQTVFPPVNSGQPPSYEMLKEEHEVAVLGAPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDLTGAQAYASTAKCLNIWALILGILMTIPLIVIPVLIYQAHR.
For Research Use Only | Not For Clinical Use.
Online Inquiry