Mouse Anti-IFNAR1 Antibody (MO-AB-13978R)


Cat: MO-AB-13978R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13978R Monoclonal Cattle (Bos taurus), Chicken, Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO13978R 100 µg
CBMOAB-45076FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO45076FYA 100 µg
MO-AB-20689W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20689W 100 µg
MO-AB-57138W Monoclonal Marmoset WB, ELISA MO57138W 100 µg
MO-AB-26507R Monoclonal Pig (Sus scrofa) WB, ELISA MO26507R 100 µg
MO-AB-02400Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02400Y 100 µg
MO-AB-11729Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11729Y 100 µg
MOXC-041W Monoclonal Chicken WB, ELISA XM41

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken, Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO13978R
SpecificityThis antibody binds to Cattle IFNAR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Lysosome; Endosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. (From NCBI)
Product OverviewMouse Anti-Cattle IFNAR1 Antibody is a mouse antibody against IFNAR1. It can be used for IFNAR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha/beta receptor 1; IFN-R-1; IFN-alpha/beta receptor 1; Type I interferon receptor 1; IFNAR1; IFNAR
UniProt IDQ04790
Protein RefseqThe length of the protein is 560 amino acids long.
The sequence is show below: MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLPNRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDESLLDKLRAALDQQLTDLQACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLREKRHNPCAWEVVRAEVMRAFSSSTNLQERFRRKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry