Mouse Anti-IFNAR1 Antibody (MO-AB-13978R)
Cat: MO-AB-13978R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-13978R | Monoclonal | Cattle (Bos taurus), Chicken, Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB, ELISA | MO13978R | 100 µg | ||
CBMOAB-45076FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO45076FYA | 100 µg | ||
MO-AB-20689W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20689W | 100 µg | ||
MO-AB-57138W | Monoclonal | Marmoset | WB, ELISA | MO57138W | 100 µg | ||
MO-AB-26507R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26507R | 100 µg | ||
MO-AB-02400Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02400Y | 100 µg | ||
MO-AB-11729Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11729Y | 100 µg | ||
MOXC-041W | Monoclonal | Chicken | WB, ELISA | XM41 |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus), Chicken, Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rhesus (Macaca mulatta) |
Clone | MO13978R |
Specificity | This antibody binds to Cattle IFNAR1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Lysosome; Endosome; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. |
Product Overview | Mouse Anti-Cattle IFNAR1 Antibody is a mouse antibody against IFNAR1. It can be used for IFNAR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Interferon alpha/beta receptor 1; IFN-R-1; IFN-alpha/beta receptor 1; Type I interferon receptor 1; IFNAR1; IFNAR |
UniProt ID | Q04790 |
Protein Refseq | The length of the protein is 560 amino acids long. The sequence is show below: MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLPNRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDESLLDKLRAALDQQLTDLQACLRQEEGLRGAPLLKEDASLAVRKYFHRLTLYLREKRHNPCAWEVVRAEVMRAFSSSTNLQERFRRKD. |
See other products for " IFNAR1 "
MOXC-039W | Mouse Anti-IFNAR1 (VPLEDKEGLF) Antibody |
MOXC-040W | Mouse Anti-IFNAR1 (EANQVRKMWL) Antibody |
MO-AB-02397Y | Mouse Anti-IFNAR1 Antibody (MO-AB-02397Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry