AibGenesis™ Mouse Anti-IGIP Antibody (MO-AB-14560W)


Cat: MO-AB-14560W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14560W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO14560W 100 µg
MO-AB-26466H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26466C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO14560W
SpecificityThis antibody binds to Chimpanzee IGIP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee IGIP Antibody is a mouse antibody against IGIP. It can be used for IGIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 5 open reading frame 53; IGIP
UniProt IDH2R142
Protein RefseqThe length of the protein is 53 amino acids long.
The sequence is show below: MCSYYHMKKRSVSGCNITIFAVMFSHLSAGNSPCGNQANVLCISRLEFVQYQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry