Mouse Anti-IL10 Antibody (CBMOAB-45237FYA)
Cat: CBMOAB-45237FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45237FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Human, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat, Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Primate, V-Virus, Viral, Cynomolgus, Rhesus, Sooty, Pig, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO45237FYA | 100 µg | ||
| CBMOAB-80563FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80563FYA | 100 µg | ||
| MO-AB-08459Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08459Y | 100 µg | ||
| MO-AB-08897W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08897W | 100 µg | ||
| MO-AB-14095R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14095R | 100 µg | ||
| MO-AB-15743Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15743Y | 100 µg | ||
| MO-AB-18699W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18699W | 100 µg | ||
| MO-AB-26472H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26472C | 100 µg | ||
| MO-AB-26623R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26623R | 100 µg | ||
| MO-AB-31250W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31250W | 100 µg | ||
| MO-AB-34946W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34946W | 100 µg | ||
| MO-AB-41862W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41862W | 100 µg | ||
| MO-AB-45118W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45118W | 100 µg | ||
| MOFY-0522-FY31 | Monoclonal | Human, Viral, Rhesus, Cynomolgus, Sooty | FC, IHC, ELISA, ELISpot, WB, Neut | 100 µg | |||
| MOFY-0522-FY65 | Monoclonal | Human, Viral, Cynomolgus | IHC, ELISA, ELISpot, WB | 100 µg | |||
| MOFY-0622-FY13 | Monoclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0622-FY35 | Monoclonal | Rabbit | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY25 | Monoclonal | Pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY41 | Monoclonal | Bovine, Human | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY70 | Monoclonal | Goat | WB, IHC, ICC, IP | 100 µg | |||
| MO-NAB-00192W | Monoclonal | Human (Homo sapiens), Primate, Rhesus (Macaca mulatta), V-Virus | WB, ELISA, FC, IHC, IHC-Fr, IHC-P, Neut, ELISA(Cap), ELISpot | NW0091 | 100 µg | ||
| MO-DKB-03068W | Polyclonal | Zebrafish (Danio rerio) | ELISA, WB | 100 µg | |||
| MO-DKB-03069W | Polyclonal | Zebrafish (Danio rerio) | ELISA | 100 µg | |||
| MOFY-0622-FY168 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY145 | Polyclonal | Dog | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY276 | Polyclonal | Pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY402 | Polyclonal | Goat | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY79 | Polyclonal | Rhesus | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Bovine, Human, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog, Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat, Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Primate, V-Virus, Viral, Cynomolgus, Rhesus, Sooty, Pig, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO45237FYA |
| Specificity | This antibody binds to Rhesus IL10. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. |
| Product Overview | Mouse Anti-Rhesus IL10 Antibody is a mouse antibody against IL10. It can be used for IL10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Interleukin 10; IL10 |
| UniProt ID | Q09I34 |
| Protein Refseq | The length of the protein is 162 amino acids long. The sequence is show below: LCCLVLLTGVRASPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry