Mouse Anti-IL10RB Antibody (CBMOAB-45243FYA)


Cat: CBMOAB-45243FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45243FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO45243FYA 100 µg
CBMOAB-80572FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80572FYA 100 µg
MO-AB-04470H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04470C 100 µg
MO-AB-08461Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08461Y 100 µg
MO-AB-14098R Monoclonal Cattle (Bos taurus) WB, ELISA MO14098R 100 µg
MO-AB-14444W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14444W 100 µg
MO-AB-26626R Monoclonal Pig (Sus scrofa) WB, ELISA MO26626R 100 µg
MO-AB-34948W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34948W 100 µg
MO-AB-57188W Monoclonal Marmoset WB, ELISA MO57188W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO45243FYA
SpecificityThis antibody binds to Rhesus IL10RB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
Product OverviewMouse Anti-Rhesus IL10RB Antibody is a mouse antibody against IL10RB. It can be used for IL10RB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-10 receptor subunit beta; IL10RB
UniProt IDH9FU05
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MARSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCTSTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVQGFLPDRNKTGEWSEPVCEKTTSDETVPSWMVAIILMASVFVVCLALLGCFALLWCIYKKTKYTFSPGNSLPQHLKEFLGHPHHNTLLFFSFPFSDENDVFDKLSVIAEDSESSKQNPDDSCSLGTPSGQGPQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry