Mouse Anti-IL18BP Antibody (CBMOAB-45285FYA)


Cat: CBMOAB-45285FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45285FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO45285FYA 100 µg
MO-AB-08467Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08467Y 100 µg
MO-AB-25486W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25486W 100 µg
MO-AB-26488H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26488C 100 µg
MO-AB-57205W Monoclonal Marmoset WB, ELISA MO57205W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO45285FYA
SpecificityThis antibody binds to Rhesus IL18BP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene functions as an inhibitor of the proinflammatory cytokine, IL18. It binds IL18, prevents the binding of IL18 to its receptor, and thus inhibits IL18-induced IFN-gamma production, resulting in reduced T-helper type 1 immune responses. This protein is constitutively expressed and secreted in mononuclear cells. Elevated level of this protein is detected in the intestinal tissues of patients with Crohn's disease. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus IL18BP Antibody is a mouse antibody against IL18BP. It can be used for IL18BP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIL18BP
UniProt IDF7EA36
Protein RefseqThe length of the protein is 185 amino acids long.
The sequence is show below: MRHNWTPDLSFLWVLLCAHIITLLVRATPVSQTTTAATASSRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEMPLSWAEDNLAPHPRSPALQPQHRATAAHSSRVKTQHRASSSTTLTRAWVLPVYLKSTVPDCLQAVWASNAPPPPLLWVPSLTKFQLHSHLPGKSQPPYNNASFSSCHFLPTH.
For Research Use Only | Not For Clinical Use.
Online Inquiry