Mouse Anti-IL1A Antibody (MO-AB-07956W)
Cat: MO-AB-07956W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-07956W | Monoclonal | Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Dog, Mouse, Ferret (Mustela Putorius Furo), Goat, Rat, Chicken, Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Ovis aries, Sheep, Pig, Human, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO07956W | 100 µg | ||
MO-AB-12519W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12519W | 100 µg | ||
MO-AB-31267W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31267W | 100 µg | ||
MO-AB-34962W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34962W | 100 µg | ||
MO-AB-41869W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41869W | 100 µg | ||
MO-AB-45134W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45134W | 100 µg | ||
MO-AB-57208W | Monoclonal | Marmoset | WB, ELISA | MO57208W | 100 µg | ||
MO-AB-14121R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14121R | 100 µg | ||
MO-AB-26493H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26493C | 100 µg | ||
MO-AB-08471Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08471Y | 100 µg | ||
MO-AB-15762Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15762Y | 100 µg | ||
MOFY-0622-FY5 | Monoclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY104 | Polyclonal | Ovis aries, Sheep | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY123 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY59 | Monoclonal | Goat, Rat, Chicken | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY227 | Polyclonal | Dog, Mouse | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY273 | Polyclonal | Pig, Human | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY394 | Polyclonal | Goat | WB, IHC, ICC | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Dog, Mouse, Ferret (Mustela Putorius Furo), Goat, Rat, Chicken, Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Ovis aries, Sheep, Pig, Human, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO07956W |
Specificity | This antibody binds to Cat IL1A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. (From NCBI) |
Product Overview | Mouse Anti-Cat IL1A Antibody is a mouse antibody against IL1A. It can be used for IL1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Interleukin-1 alpha; IL-1 alpha; IL1A |
UniProt ID | O46613 |
Protein Refseq | The length of the protein is 270 amino acids long. The sequence is show below: MAKVPDLFEDLKNCYSENEEYSSEIDHLTLNQKSFYDASYDPLHEDCTDKFMSPSTSETSKTPQLTLKKSVVMVAANGKILKKRRLSLNQFLTADDLEAIANEVEEEIMKPRSVAPNFYSSEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPKLFIATQEEQLVHMARGLPSVTDFQILETQS. |
See other products for " IL1a "
MOFY-0722-FY162 | Rabbit Anti-IL1a Antibody (MOFY-0722-FY162) |
MOFY-0722-FY60 | Biotin conjugated antibody to IL1a Antibody (MOFY-0722-FY60) |
MOFY-0722-FY369 | Rabbit Anti-IL1a Antibody (MOFY-0722-FY369) |
MO-AB-37493W | Mouse Anti-IL1A Antibody (MO-AB-37493W) |
MOFY-0622-FY181 | Rabbit Anti-IL1a Antibody (MOFY-0622-FY181) |
MOFY-0722-FY383 | Rabbit Anti-IL1a Antibody (MOFY-0722-FY383) |
For Research Use Only | Not For Clinical Use.
Online Inquiry