AibGenesis™ Mouse Anti-IL1RL1 Antibody (CBMOAB-45297FYA)


Cat: CBMOAB-45297FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45297FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa) WB, ELISA MO45297FYA 100 µg
CBMOAB-80662FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80662FYA 100 µg
MO-AB-11826Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11826Y 100 µg
MO-AB-17659W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17659W 100 µg
MO-AB-26663R Monoclonal Pig (Sus scrofa) WB, ELISA MO26663R 100 µg
MO-DKB-00337W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa)
CloneMO45297FYA
SpecificityThis antibody binds to Rhesus IL1RL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus IL1RL1 Antibody is a mouse antibody against IL1RL1. It can be used for IL1RL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIL1RL1
UniProt IDF7H8H8
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MGLWILAILTILVYSTAAKFSKQSWGLENEALIVRCPRQGKPSYIVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQPDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYKAHKSFLVIDNVMTDDAGDYTCKFIHNENGANYSVTATRSFTVKEYYWKEVKVGTNLLFSNTHWIQSLMRGFMMRYYGVHKCYCVDFNPCLYFQYHQWP.
For Research Use Only | Not For Clinical Use.
Online Inquiry