AibGenesis™ Mouse Anti-immp1l Antibody (CBMOAB-80821FYA)


Cat: CBMOAB-80821FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-80821FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO80821FYA 100 µg
MO-AB-14167R Monoclonal Cattle (Bos taurus) WB, ELISA MO14167R 100 µg
MO-AB-26532H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26532C 100 µg
MO-AB-57241W Monoclonal Marmoset WB, ELISA MO57241W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO80821FYA
SpecificityThis antibody binds to Zebrafish immp1l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish immp1l Antibody is a mouse antibody against immp1l. It can be used for immp1l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesimmp1l; Inner Mitochondrial Membrane Peptidase Subunit 1
UniProt IDE7FGX8
Protein RefseqThe length of the protein is 189 amino acids long.
The sequence is show below: MIEEYKHHACNEHYSELLIVIKSVRMFRGFFVKTISFVGYTVQYGCIAHCAFEYVGEFVSCSGPSMEPTITNHDVVFSERISRHLYRIQKGDIIIAKSPSNPKMNICKRVIGLEGDKVCTSGPSDIFKTHTYVPRGHVWLEGDNLRNSTDSRSYGPIPYALIRGRVCLKLWPPQSFGVLAESPNDGRIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry