Mouse Anti-ING1 Antibody (MO-AB-06578Y)
Cat: MO-AB-06578Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-06578Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO06578Y | 100 µg | ||
CBMOAB-45398FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO45398FYA | 100 µg | ||
MO-AB-07609W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07609W | 100 µg | ||
MO-AB-20291W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20291W | 100 µg | ||
MO-AB-31308W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31308W | 100 µg | ||
MO-AB-34982W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34982W | 100 µg | ||
MO-AB-45165W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45165W | 100 µg | ||
MO-AB-57263W | Monoclonal | Marmoset | WB, ELISA | MO57263W | 100 µg | ||
MO-AB-26537H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26537C | 100 µg | ||
MO-AB-33320H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33320C | 100 µg | ||
MO-AB-00663L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00663L | 100 µg | ||
MO-AB-15809Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15809Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | O. anatinus (Ornithorhynchus anatinus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
Clone | MO06578Y |
Specificity | This antibody binds to O. anatinus ING1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Product Overview | This product is a mouse antibody against ING1. It can be used for ING1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Inhibitor of growth protein; ING1 |
UniProt ID | F7GA14 |
Protein Refseq | The length of the protein is 300 amino acids long. The sequence is show below: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQDILKELDDYYEKFKRETDPGQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFETRQEANDPTGNGGKAGPEKAKNETMGQAEKPNNKRSRRQRNNENRENASNNHDHDDLTSGTPKEKKAKTSKKKKRSKAKAEREPSPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNRRRWFFLSGNLKNSFARQAYLN. |
See other products for " ing1 "
MO-AB-04500H | Mouse Anti-ing1 Antibody (MO-AB-04500H) |
CBMOAB-80870FYA | Mouse Anti-ing1 Antibody (CBMOAB-80870FYA) |
CBMOAB-35206FYC | Mouse Anti-ING1 Antibody (CBMOAB-35206FYC) |
MO-AB-14185R | Mouse Anti-ING1 Antibody (MO-AB-14185R) |
MO-DKB-01550W | Rabbit Anti-ING1 Antibody (MO-DKB-01550W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry