Mouse Anti-ING1 Antibody (MO-AB-06578Y)


Cat: MO-AB-06578Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06578Y Monoclonal O. anatinus (Ornithorhynchus anatinus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO06578Y 100 µg
CBMOAB-45398FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO45398FYA 100 µg
MO-AB-07609W Monoclonal Cat (Felis catus) WB, ELISA MO07609W 100 µg
MO-AB-20291W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20291W 100 µg
MO-AB-31308W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31308W 100 µg
MO-AB-34982W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34982W 100 µg
MO-AB-45165W Monoclonal Horse (Equus caballus) WB, ELISA MO45165W 100 µg
MO-AB-57263W Monoclonal Marmoset WB, ELISA MO57263W 100 µg
MO-AB-26537H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26537C 100 µg
MO-AB-33320H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33320C 100 µg
MO-AB-00663L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00663L 100 µg
MO-AB-15809Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15809Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. anatinus (Ornithorhynchus anatinus), Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO06578Y
SpecificityThis antibody binds to O. anatinus ING1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Product OverviewThis product is a mouse antibody against ING1. It can be used for ING1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesInhibitor of growth protein; ING1
UniProt IDF7GA14
Protein RefseqThe length of the protein is 300 amino acids long. The sequence is show below: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQDILKELDDYYEKFKRETDPGQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFETRQEANDPTGNGGKAGPEKAKNETMGQAEKPNNKRSRRQRNNENRENASNNHDHDDLTSGTPKEKKAKTSKKKKRSKAKAEREPSPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNRRRWFFLSGNLKNSFARQAYLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry