Mouse Anti-INSM1 Antibody (CBMOAB-45459FYA)


Cat: CBMOAB-45459FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45459FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO45459FYA 100 µg
MO-AB-14218R Monoclonal Cattle (Bos taurus) WB, ELISA MO14218R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO45459FYA
SpecificityThis antibody binds to Rhesus INSM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus INSM1 Antibody is a mouse antibody against INSM1. It can be used for INSM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInsulinoma-associated protein 1; INSM1
UniProt IDH9F4R8
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: DRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPPAPPAEDLLALYPGPDEKAPQEAAGDGEAAGVLGLSASAECHLCPVCGESFPSKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENRQVILLQVPVRPAC.
For Research Use Only | Not For Clinical Use.
Online Inquiry