Mouse Anti-Ints10 Antibody (CBMOAB-21122FYA)


Cat: CBMOAB-21122FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-21122FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO21122FYA 100 µg
CBMOAB-45471FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO45471FYA 100 µg
CBMOAB-80969FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80969FYA 100 µg
MO-AB-14222R Monoclonal Cattle (Bos taurus) WB, ELISA MO14222R 100 µg
MO-AB-23235W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23235W 100 µg
MO-AB-57314W Monoclonal Marmoset WB, ELISA MO57314W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO21122FYA
SpecificityThis antibody binds to fruit fly Ints10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionINTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).
Product OverviewMouse Anti-D. melanogaster Ints10 Antibody is a mouse antibody against Ints10. It can be used for Ints10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrator 10; RE59992p; IntS10
UniProt IDQ9VZM7
Protein RefseqThe length of the protein is 631 amino acids long.
The sequence is show below: MPSQEENELYMVKEAQRLRKSDPCAAMAWIITAKTLYPNAFNLQYEAYLLERDAQNYEEAAKCFSAIATNFQNQHTELWQEINSLTNALRNENETTPEHEFYVKMYKHLTPEVQHNIFMHTINHSADNLERIYIYILMFNKFPKSAITQAPRLLEMLAEGMKTEPDLYQRILVEEVLPMIQNKPPELSPNLACRLYTSSLEFYLRQIMDESDTADAWKNIFKVLMICGQMMGWEPFLPFSKHVNQNVYWEKLVDILSGSPAGSSQVLFYATTLFIYSLHGYIRNCKLRIEDADVTHVLVEGFMEWSPEGDGSEVPSMEPPKFSLTTAISPELSKAFLHAAQCWQLLNTDQFQRDFSQLMLALPLAPWISRFLFDLAIYFGHRDEANKLMADMTTQSSLVQSLQILSLNLMQGSMTLQGFQCILKILSELPTTQGQLLENMSLKGHRHMVFLPLTRSALVQYCVGAIISRLSRKVFEPNVPDRLLGDILVLQQLNLLNDVLLTQQIFNLIKQRKSFNLRTLSTYIINIDLLEELSHIWNSQQEDNFELTSSPNSSGTPTATTVAGGSQSRRIGTRGADKGARDEFRAITRQQIARCNENVITLLANFINQEHLMLAQHIFGISQPVETIVIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry