AibGenesis™ Mouse Anti-ipo8 Antibody (CBMOAB-81012FYA)


Cat: CBMOAB-81012FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-81012FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO81012FYA 100 µg
MO-AB-15003W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15003W 100 µg
MO-AB-57338W Monoclonal Marmoset WB, ELISA MO57338W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO81012FYA
SpecificityThis antibody binds to Zebrafish ipo8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish ipo8 Antibody is a mouse antibody against ipo8. It can be used for ipo8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesipo8; Importin 8
UniProt IDA5WW24
Protein RefseqThe length of the protein is 1024 amino acids long.
The sequence is show below: MDPNRIIQALKGTIDPNLRLAAENELNQSYKIINFAPTLLQIIVSEQVEFPVRQAAAIYLKNMVSQYWQDREPTLGEVVFPFNIHENDRGQIRENMVEAIIRCPESIRAQLTVCLRAIIKHDFPGRWTGVVDKINLYLQSQNSGSWYGSLLALYQLVKNYEFKKAEERDPLLAAMQIFLPRLQQLITQLLSDATFISVLIQKQILKIFHALVQLINNTVMTHWMEILRTVVDRDVPAIWFSECLRGGFQETLEADEDDRPELIWWKCKKWALHILTRIFERYGSPGNVTKEYVEFADFFLKTYALGIQQVLLKVMEQHRQRQYVSPRVLQQTLSFMTQGVSHSLTWRQMKPHMQTITHELVFPLMCYKDEDERLWQEDPYEYIRMKFNVYDDHVSPATAAQTLLCTAARKRKEVLPQMMEFCHQILVDPSADPRRTDGALHVIGTLAQPLLKKRVYRDQMELMLQNYVFPLLNSNLAYLRARSCWVLHSFSPLKFHNELVLRNAVELVKHNLVEDKEMPVKVEAAIALQTLVRNQEQAKVYIRPFIRPVMQELLHIIKETENDDLTGVIQKMICEYSEEVTVIAVDMTQNLAEIFSKILQSEEYEESEDKTVMALGILSTIDTILTVMGDRKEISQQLEGICLQVIGLVLQKPIIGMAEFYEEILSLAFGLTCYCISPQMWQLLGVLYDVFQHDCFDYFTDMMPLLHNYVTVDTNMLLSDPKYLEVIYTMCKKVLTSDAGEDPECHAAKLLEVIILQCRGRGIDQCIPLFVEAVLERLTRGVKSSELRTMCLQVVIAALYYNPTLLIHTLENIRFPHSPEPITAQFINQWMNDTEFFLGLHDRKMCVIGLSILMELPSRPAVLEEVVGQIVPSVLLLFLGLKHIYASRVLNKPEQFGRAQGSEEEENEEIPSDEDEVGEKGVALQPSVAPTGNDNEDDDDEDDDEYWDDEGLEGTPLEEYSTPLDCDNGEDEYQFFTASLLRVQSSDAGWYQSLTSPLNEDQRKQLQEIYNLAQQRRSTGVKGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry