AibGenesis™ Mouse Anti-isg12(b) Antibody (CBMOAB-45590FYA)


Cat: CBMOAB-45590FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45590FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Sheep (Ovis aries) WB, ELISA MO45590FYA 100 µg
MO-AB-14295R Monoclonal Cattle (Bos taurus) WB, ELISA MO14295R 100 µg
MO-AB-15832Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15832Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Sheep (Ovis aries)
CloneMO45590FYA
SpecificityThis antibody binds to Rhesus isg12(b).
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus isg12(b) Antibody is a mouse antibody against isg12(b). It can be used for isg12(b) detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative ISG12(B) protein; isg12(b)
UniProt IDQ6IE99
Protein RefseqThe length of the protein is 39 amino acids long.
The sequence is show below: RGAQMPWRFTGAGIAAVSIAGKMMSAAAIANGGGVSAGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry