Mouse Anti-ITGA2B Antibody (CBMOAB-45621FYA)


Cat: CBMOAB-45621FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45621FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Cat (Felis catus), Mink (Martes), Ferret (Mustela putorius furo), Zebrafish (Danio rerio) WB, ELISA MO45621FYA 100 µg
CBMOAB-00155FYA Monoclonal Dog (Canis lupus familiaris), Cat (Felis catus), Mink (Martes), Ferret (Mustela putorius furo) FC F00155FYA 100 µg
CBMOAB-81228FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81228FYA 100 µg
MO-AB-14316R Monoclonal Cattle (Bos taurus) WB, ELISA MO14316R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Cat (Felis catus), Mink (Martes), Ferret (Mustela putorius furo), Zebrafish (Danio rerio)
CloneMO45621FYA
SpecificityThis antibody binds to Rhesus ITGA2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the integrin alpha chain family of proteins. The encoded preproprotein is proteolytically processed to generate light and heavy chains that associate through disulfide linkages to form a subunit of the alpha-IIb/beta-3 integrin cell adhesion receptor. This receptor plays a crucial role in the blood coagulation system, by mediating platelet aggregation. Mutations in this gene are associated with platelet-type bleeding disorders, which are characterized by a failure of platelet aggregation, including Glanzmann thrombasthenia. (From NCBI)
Product OverviewMouse Anti-Rhesus ITGA2B Antibody is a mouse antibody against ITGA2B. It can be used for ITGA2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesITGA2B
UniProt IDF7E7I7
Protein RefseqThe length of the protein is 1045 amino acids long.
The sequence is show below: MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGSVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENNFSSDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTRNPLRAGYVVGAPTWSWTLGAVEILGSYFQRLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHTLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDTANEGEGAYEAELAVHLPQGAHYMRARSNVEGFERLICNQKKENETRVVLCELGNPMKKNTQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQHSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPTPSPSPVHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAWFNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry