Mouse Anti-itga7 Antibody (CBMOAB-81249FYA)


Cat: CBMOAB-81249FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-81249FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO81249FYA 100 µg
MO-AB-03865W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03865W 100 µg
MO-AB-12032W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12032W 100 µg
MO-AB-45195W Monoclonal Horse (Equus caballus) WB, ELISA MO45195W 100 µg
MO-AB-57407W Monoclonal Marmoset WB, ELISA MO57407W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta)
CloneMO81249FYA
SpecificityThis antibody binds to Zebrafish itga7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. They mediate a wide spectrum of cell-cell and cell-matrix interactions, and thus play a role in cell migration, morphologic development, differentiation, and metastasis. This protein functions as a receptor for the basement membrane protein laminin-1. It is mainly expressed in skeletal and cardiac muscles and may be involved in differentiation and migration processes during myogenesis. Defects in this gene are associated with congenital myopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish itga7 Antibody is a mouse antibody against itga7. It can be used for itga7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesitga7; Integrin Subunit Alpha 7
UniProt IDE7FGC7
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MSLWVAAAVLLSAVFSRTSAFNLDTTTILTKEGEQGSFFGFSVALHQQITPEPRSWLLVGAPQARGEGPLQSRRPGALYRCPVTAEPCQRVDVDAHENLDRENKDNQWFGVTVKSQGAGGKVVVCAHLYELRQHVNQSFETRDPVGRCYVLSADLTERDDLDGGEWKFCEGRPQGHEQFGFCQQGLSASFSPDRNFLLLGAPGTYNWKGLLFMANPVEDALVYKTLEASKSSYEDVAQNSY.
For Research Use Only | Not For Clinical Use.
Online Inquiry