AibGenesis™ Mouse Anti-ITGB7 Antibody (MO-AB-15845Y)


Cat: MO-AB-15845Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15845Y Monoclonal Sheep (Ovis aries), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO15845Y 100 µg
CBMOAB-45653FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO45653FYA 100 µg
CBMOAB-81293FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81293FYA 100 µg
MO-AB-09281W Monoclonal Cat (Felis catus) WB, ELISA MO09281W 100 µg
MO-AB-25883W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25883W 100 µg
MO-AB-31342W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31342W 100 µg
MO-AB-35011W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35011W 100 µg
MO-AB-45208W Monoclonal Horse (Equus caballus) WB, ELISA MO45208W 100 µg
MO-AB-14342R Monoclonal Cattle (Bos taurus) WB, ELISA MO14342R 100 µg
MO-AB-26757R Monoclonal Pig (Sus scrofa) WB, ELISA MO26757R 100 µg
MO-AB-00684L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00684L 100 µg
MO-AB-08525Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08525Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO15845Y
SpecificityThis antibody binds to Sheep ITGB7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms dimers with an alpha4 chain or an alphaE chain and plays a role in leukocyte adhesion. Dimerization with alpha4 forms a homing receptor for migration of lymphocytes to the intestinal mucosa and Peyer''s patches. Dimerization with alphaE permits binding to the ligand epithelial cadherin, a calcium-dependent adhesion molecule. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (From NCBI)
Product OverviewThis product is a mouse antibody against ITGB7. It can be used for ITGB7 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin beta; ITGB7
UniProt IDW5Q588
Protein RefseqThe length of the protein is 798 amino acids long. The sequence is show below: MVALSMVLVFLLALSRGESELDAKSSSPQEATEWRDPNLSRPGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCLXRQEMLQDDPLSQGTRGEGATRLAPQRVRVTLRPGEPQQLRVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRNTRASPALSRPPPTLQESFGSFVDKTVLPFVSTVPSKLRHPCPSRLESCQSPFSFHHVLSLTGDAKAFEREVGRQNVSGNLDSPEGGFDAILQAALCQKQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYRELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHDSLLPPGVRISYESQCGDSEKRLGEAADRGQCNHVRINQTVNFWVTFQATRCLPEPHLLRFRARGFSEELTVELHTLCDCNCSDAQLQAPHCSDGQGHLQCGVCSCVPGRLGRLCECSEAELSSPDLESGCRAPNGTGPLCSGRGQCQCGRCTCSGQSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDTDNCVSPDGGLCSGHGHCNCNRCQCNDGYYGALCDQCSGCKTPCETHRDCAECKAFGTGPLAMNCSTACAHANTTLVLTPTLDDSWCKERTQDNQLFFFLAEDVAGGRVVLTVRPPEEGADHTQIIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREFHRFEKERQHLNWKQDHNPLYQSAITTTVNPRFQEADSPLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry