AibGenesis™ Mouse Anti-Jra Antibody (CBMOAB-22084FYA)


Cat: CBMOAB-22084FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22084FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO22084FYA 100 µg
MO-DKB-03101W Polyclonal Fruit fly (Drosophila melanogaster) CM, ELISA, ICC, IF, IHC, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO22084FYA
SpecificityThis antibody binds to fruit fly Jra.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3' (PubMed:1696724, PubMed:2116361). Plays a role in dorsal closure (PubMed:9224723). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Jra Antibody is a mouse antibody against Jra. It can be used for Jra detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor AP-1; Jun-related antigen; dJRA; dJun; Jra; jun
UniProt IDP18289
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry