Mouse Anti-JTB Antibody (CBMOAB-45762FYA)


Cat: CBMOAB-45762FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45762FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45762FYA 100 µg
CBMOAB-81460FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81460FYA 100 µg
MO-AB-14409R Monoclonal Cattle (Bos taurus) WB, ELISA MO14409R 100 µg
MO-AB-26798R Monoclonal Pig (Sus scrofa) WB, ELISA MO26798R 100 µg
MO-AB-26592H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26592C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45762FYA
SpecificityThis antibody binds to Rhesus JTB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus JTB Antibody is a mouse antibody against JTB. It can be used for JTB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesJTB
UniProt IDF7AM50
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: MPADSGRHGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVTTECSPCSNFQAKTTPECGPTGYVEKITCSSSKRIEFKSCRSALMEQHLFWKFEGAVVFVALIFACLVIIRQRQLDRKALEKVRKQIESI.
For Research Use Only | Not For Clinical Use.
Online Inquiry