Mouse Anti-katnbl1 Antibody (CBMOAB-81545FYA)


Cat: CBMOAB-81545FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-81545FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO81545FYA 100 µg
MO-AB-04614H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04614C 100 µg
MO-AB-13574W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13574W 100 µg
MO-AB-57557W Monoclonal Marmoset WB, ELISA MO57557W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO81545FYA
SpecificityThis antibody binds to Zebrafish katnbl1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates microtubule-severing activity of KATNAL1 in a concentration-dependent manner in vitro. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish katnbl1 Antibody is a mouse antibody against katnbl1. It can be used for katnbl1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:ch211-150c22.2; katnbl1; si:ch211-150c22.
UniProt IDQ5XJA1
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MATGSHVGSNAEVHRLKQAQPHDLLKRMLCSGDEKNMREVDYLLKDETDQERFPVGRCVHKYSKTKREVVGKKKTRLSGVGPRACRKLPTTSRTSDMANKENELTCVDEVQAFLYSDNCGFPVNSTDAKMAGAGSKYSDYFTELSKDHEAMSHVLFGRNLRLNVALTLWRKNASELVAYLNRIQDTGVLVDCLPVLTKSLQGEQPCISLGCCVDLFPQVKMILNTKYEEHLIVALHWVQSIIKKWWSELSTNNKSLPESSSNDRNVQAMKTMLLELWQGKSHLSSVPGTVGETAKVIESYVSQLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry