AibGenesis™ Mouse Anti-KCNK2 Antibody (CBMOAB-45907FYA)


Cat: CBMOAB-45907FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45907FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO45907FYA 100 µg
MO-AB-03943W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03943W 100 µg
MO-AB-14472R Monoclonal Cattle (Bos taurus) WB, ELISA MO14472R 100 µg
MO-AB-20101W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20101W 100 µg
MO-AB-57640W Monoclonal Marmoset WB, ELISA MO57640W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO45907FYA
SpecificityThis antibody binds to Rhesus KCNK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane potential. The channel can be opened, however, by certain anesthetics, membrane stretching, intracellular acidosis, and heat. Three transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus KCNK2 Antibody is a mouse antibody against KCNK2. It can be used for KCNK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKCNK2
UniProt IDF7CHV4
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: VAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQVMAWEELLLHLNVELSQIASWTKLTSSNFTVCCAYVCIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry