Mouse Anti-KCTD6 Antibody (CBMOAB-45996FYA)


Cat: CBMOAB-45996FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45996FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45996FYA 100 µg
CBMOAB-81781FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81781FYA 100 µg
MO-AB-14503R Monoclonal Cattle (Bos taurus) WB, ELISA MO14503R 100 µg
MO-AB-15063W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15063W 100 µg
MO-AB-26632H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26632C 100 µg
MO-AB-57695W Monoclonal Marmoset WB, ELISA MO57695W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45996FYA
SpecificityThis antibody binds to Rhesus KCTD6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex mediating the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the ubiquitination of HDAC1; the function seems to depend on KCTD11:KCTD6 oligomerization. Can function as antagonist of the Hedgehog pathway by affecting the nuclear transfer of transcription factor GLI1; the function probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. Inhibits cell growth and tumorigenicity of medulloblastoma (MDB) (PubMed:21472142). Involved in regulating protein levels of ANK1 isoform Mu17 probably implicating CUL3-dependent proteasomal degradation (PubMed:22573887). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus KCTD6 Antibody is a mouse antibody against KCTD6. It can be used for KCTD6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKCTD6
UniProt IDF7H0P7
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: FQMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry