AibGenesis™ Mouse Anti-KIAA0040 Antibody (CBMOAB-46076FYA)


Cat: CBMOAB-46076FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46076FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO46076FYA 100 µg
MO-AB-57766W Monoclonal Marmoset WB, ELISA MO57766W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO46076FYA
SpecificityThis antibody binds to Rhesus KIAA0040.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionKIAA0040 (KIAA0040) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus KIAA0040 Antibody is a mouse antibody against KIAA0040. It can be used for KIAA0040 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein KIAA0040; KIAA0040
UniProt IDH9F225
Protein RefseqThe length of the protein is 53 amino acids long.
The sequence is show below: MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFMCCHCCWS.
For Research Use Only | Not For Clinical Use.
Online Inquiry