Mouse Anti-Kin17 Antibody (CBMOAB-22219FYA)


Cat: CBMOAB-22219FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22219FYA Monoclonal Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae) WB, ELISA MO22219FYA 100 µg
MO-AB-43223W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43223W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Hamsters (Cricetinae)
CloneMO22219FYA
SpecificityThis antibody binds to fruit fly Kin17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Kin17 Antibody is a mouse antibody against Kin17. It can be used for Kin17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFI03293p; Kin17; kin17
UniProt IDQ9VPH4
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MGRAEVGTPKYLANKMKSKGLQKLRWYCQMCEKQCRDENGFKCHTMSESHQRQLLLFADNPGKFLHSFSKEFSDGYMELLRRRFGTKRTSANKIYQEYIAHKEHIHMNATRWLTLSDYVKWLGRTGQVIADETEKGWFVTYIDRSPEAMERQAKADRKEKMEKDDEERMADFIEQQIKNAKAKDGEEDEGQEKFTELKREENEPLKLDIRLEKKFQPDTVLGKSALAKRPAPEAEEKVFKKPKSVAGDSQTRSVLDEIIKQEESKKERANRKDYWLHKGIVVKFISKSMGEKFFKQKAVVLDVIDRYQGKIKFLETGEKLKVDQAHLETVIPALDKPVMVVNGAYRGSEALLRKLDERRYSVSVEILHGPLKGRIVDNVQYEDISKLHGA.
For Research Use Only | Not For Clinical Use.
Online Inquiry