Mouse Anti-klf6 Antibody (MO-AB-04710H)


Cat: MO-AB-04710H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04710H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO04710C 100 µg
MO-AB-14636R Monoclonal Cattle (Bos taurus) WB, ELISA MO14636R 100 µg
MO-AB-23861W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23861W 100 µg
MO-AB-26900R Monoclonal Pig (Sus scrofa) WB, ELISA MO26900R 100 µg
MO-AB-57910W Monoclonal Marmoset WB, ELISA MO57910W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO04710C
SpecificityThis antibody binds to Frog klf6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. (From NCBI)
Product OverviewThis product is a mouse antibody against klf6. It can be used for klf6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCopeb-prov protein; klf6
UniProt IDQ7ZXK7
Protein RefseqThe length of the protein is 283 amino acids long.
The sequence is show below: MDVLPMCSIFQELQIVHDTGYFSALPSLEEYWQQTCLELERYLQSEPCYVSAAEFKFDREEELWTKFIFACEKKEEPDQNISCVSPEDISDCQNSETNSLNSDVSSESSDSSEELSPTSKFTSDTISDVLATNGTLSSSVTSTPPSSPEQSKDPSCHLWNAVTGELHSPGKVRCGSFGKTLEHGSPTGGESSPDGRKRIHKCLFNGCKKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHI.
For Research Use Only | Not For Clinical Use.
Online Inquiry