Mouse Anti-KRT73 Antibody (MO-AB-08816W)


Cat: MO-AB-08816W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08816W Monoclonal Cat (Felis catus), Cattle (Bos taurus) WB, ELISA MO08816W 100 µg
MO-AB-14739R Monoclonal Cattle (Bos taurus) WB, ELISA MO14739R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus)
CloneMO08816W
SpecificityThis antibody binds to Cat KRT73.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionKeratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13. (From NCBI)
Product OverviewMouse Anti-Cat KRT73 Antibody is a mouse antibody against KRT73. It can be used for KRT73 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKeratin 73; KRT73
UniProt IDM1RGZ2
Protein RefseqThe length of the protein is 540 amino acids long.
The sequence is show below: MNRQFTYKSGAAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFGSRSLYSLGGARSISLNMASGSGRAGGYGFGRNRASGFAGSMFGSVALGPVCPTVCPPGGIHQVTVNKNLLAPLNVELDPEIQKVRSQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPILEGYISNLRKQLETLSGDRVRLDSELRSMRDVVEDYKKRYEEEINKRTTAENEFVVLKKDVDAAYMSKVELQAKVDALDGEIKFFKCLYEGEIAQIQSHISDTSVILSMDNNRNLDLDSIITEVRAQYEEIALKSKAEAEALYQTKFQELQLVAGRHGDDLKHTKNEISELTRLIQRLRSEIESVKKQCSNLEMAIADAEQRGDSALKDARAKLDELEAALHQAKEELARMLREYQELMSTKLALDVEIATYRKLLEGEECRMSGEHTNSVSISVISSTVAGTTGTGAGFGFSGSGTFGYRPSSVSGGYGMLSGGCVTGSGNCGPRGEAKTRLGSASEFKDAQGKTSALSSPTKKTTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry