AibGenesis™ Mouse Anti-KRTAP1-4 Antibody (MO-AB-04053W)


Cat: MO-AB-04053W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04053W Monoclonal Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO04053W 100 µg
MO-AB-15971Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15971Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO04053W
SpecificityThis antibody binds to Rhesus KRTAP1-4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KRTAP1-4 Antibody is a mouse antibody against KRTAP1-4. It can be used for KRTAP1-4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKeratin Associated Protein 1-4; High Sulfur Keratin-Associated Protein 1.4; Keratin-Associated Protein 1.4; KRTAP1.4; KAP1.4; Keratin-Associated Protein 1-4
UniProt IDF7GZ43
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MACCQTSFCGFPSCSTSGTCGSSCCQPSCCETSCCQPRCSCQTSFCGFPSFSTSGTCGSSCCQPSCCETSCCQPSCCQTSSCGTSYGIGGGIGYGQEGSSGSVSTRIRWCRPDCRVEGTYLPPCCVVSCTPPSCCQLHHAEASCCRPSYCGQSCCRPVCCCYSCEPSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry