AibGenesis™ Mouse Anti-KRTAP13-1 Antibody (MO-AB-14758R)


Cat: MO-AB-14758R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14758R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO14758R 100 µg
MO-AB-26703H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26703C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO14758R
SpecificityThis antibody binds to Cattle KRTAP13-1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle KRTAP13-1 Antibody is a mouse antibody against KRTAP13-1. It can be used for KRTAP13-1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKeratin associated protein 13-1; KRTAP13-1
UniProt IDA1A4M9
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MSYNCCSGNFSSRSLRDHLRYSGSSCGSSFPSNLVYRTDLCSPSSCQLDSSLYSQETCCEPIRTQTVVSSPCQTSCYRPRTCTFFSPCQTTCSGSLGFGSSNFQSIGHVFPSLGFGSGGFQSVGHSPNIFSSLSCRSSFYRPTFFSSRSGRSLSFQPTCGSGFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry