AibGenesis™ Mouse Anti-KY Antibody (CBMOAB-46679FYA)


Cat: CBMOAB-46679FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46679FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO46679FYA 100 µg
CBMOAB-82321FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82321FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO46679FYA
SpecificityThis antibody binds to Rhesus KY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the transglutaminase-like superfamily. The protein is involved in the function, maturation and stabilization of the neuromuscular junction and may be required for normal muscle growth. Mutations in this gene are associated with myopathy, myofibrillar, 7. (From NCBI)
Product OverviewMouse Anti-Rhesus KY Antibody is a mouse antibody against KY. It can be used for KY detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKY
UniProt IDF6R9T0
Protein RefseqThe length of the protein is 563 amino acids long.
The sequence is show below: MELKKDINAVSIDMLLIVHSEKRRAAQGTHSDQQADPSALLQRRGGFQGIGNGVRRWQKLEGNDLHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQLLKKFSLAKRLQGDKNGNTRPRQPGGKDAHAYPWDRSSLKSMSLDLRQFEKLDLHASQVTAKSGLDELVSDLLQEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRIAGVQCMTVPGYSGFGYQTGQSFSGEFDHAWNAVYLEGRWHLVDSTWGSGLVDTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPTLFMFMLNGKQEHGLLSLRKNGMKLEVYPPTMGTHKLQIFAKGNSDIYSSVLEYTLKCNYVDMGVRLPAELHQPVGPSWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEEGINVLASLHGDDGPITEETQRRYIFQLHWEKRTELKVQLPHAGKFALKIFEVYVMVLENANHNFYSYILKYKVNAQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry