AibGenesis™ Mouse Anti-LACTB2 Antibody (CBMOAB-46701FYA)


Cat: CBMOAB-46701FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46701FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO46701FYA 100 µg
CBMOAB-82348FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82348FYA 100 µg
MO-AB-14784R Monoclonal Cattle (Bos taurus) WB, ELISA MO14784R 100 µg
MO-AB-58018W Monoclonal Marmoset WB, ELISA MO58018W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO46701FYA
SpecificityThis antibody binds to Rhesus LACTB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LACTB2 Antibody is a mouse antibody against LACTB2. It can be used for LACTB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLACTB2
UniProt IDF7EDA3
Protein RefseqThe length of the protein is 291 amino acids long.
The sequence is show below: MAAILQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYIRCLKQALTEFNTAIQEIVVTHWHHDHSGGIGDICKSINNGLDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTIFEDLYDYMNSLKELLKIKADIIYPGGKPVVSDDESNIQEHHSSRLHRFIRIIYLVDYRNGKLIISQIRSYATFLDNTPENLHEMAKRNLLLHLKKLEKEGKIFSSTDPDKKWKAHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry