AibGenesis™ Mouse Anti-LCN12 Antibody (CBMOAB-46812FYA)


Cat: CBMOAB-46812FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46812FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO46812FYA 100 µg
MO-AB-26755H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26755C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO46812FYA
SpecificityThis antibody binds to Rhesus LCN12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LCN12 Antibody is a mouse antibody against LCN12. It can be used for LCN12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLCN12
UniProt IDF7GRA3
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MRLPCGLWLWLSLLKVLQGQTPSPPTLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNPFTATFELSDDGRFEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVGPGADREETRVVNSDYTQFALMLSRRHTSKLAVLRISLLSRNWLLPPGTLDQFFCLSRAQGLSDDNIVFPDVTGNVARLRACWALGTGPAGVSLVDPRGAGLSVCPGSSVPACTQGSQGSWVPALNPGSEPPPPAPGPLSWAASSRPGSPVPGRLLLSRVPCPGPPPPTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry