AibGenesis™ Mouse Anti-LCR35 Antibody (CBMOAB-35686FYC)


Cat: CBMOAB-35686FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35686FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35686FC 100 µg
MO-AB-00642H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00642C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35686FC
SpecificityThis antibody binds to Arabidopsis LCR35.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR35 Antibody is a mouse antibody against LCR35. It can be used for LCR35 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative defensin-like protein 154; Putative low-molecular-weight cysteine-rich protein 35; Protein LCR35; LCR35; At2g22121
UniProt IDP82750
Protein RefseqThe length of the protein is 78 amino acids long. The sequence is show below: MAKISYSYFLVLMLVVSVFSVVEKAKGDGSCTIIIDPKAPSCDIIQCRLSCITDYNGLAECIASRIGSPPNCVCTYDC.
For Research Use Only | Not For Clinical Use.
Online Inquiry