Mouse Anti-LEPREL2 Antibody (CBMOAB-46866FYA)


Cat: CBMOAB-46866FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46866FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO46866FYA 100 µg
CBMOAB-82610FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82610FYA 100 µg
MO-AB-58128W Monoclonal Marmoset WB, ELISA MO58128W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO46866FYA
SpecificityThis antibody binds to Rhesus LEPREL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LEPREL2 Antibody is a mouse antibody against LEPREL2. It can be used for LEPREL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProlyl 3-hydroxylase 3; LEPREL2
UniProt IDH9F6V9
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: AQLARAGTVGTQGAKLLLEVSERVRTLTQAYFSPERPLHLSFTHLVCRSAIEGEQEQRMDLSHPVHADNCVLDPDTGECWREPPAYTYRDYSGLLYLNDDFQGGDLFFTEPNALTVTARVRPRCGRLVAFSSGGENPHGVWAVTRGRRCALALWHTWAPEHREQEWIEAQELLQESEEEEEEEEEEMPSKDPSPEPPSRRHQRVQDKAGKAPRVREEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry