Mouse Anti-LHFPL5 Antibody (CBMOAB-46917FYA)


Cat: CBMOAB-46917FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46917FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO46917FYA 100 µg
MO-AB-26792H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26792C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO46917FYA
SpecificityThis antibody binds to Rhesus LHFPL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LHFPL5 Antibody is a mouse antibody against LHFPL5. It can be used for LHFPL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLHFPL5
UniProt IDF6SFI5
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFICNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTGNP.
For Research Use Only | Not For Clinical Use.
Online Inquiry