AibGenesis™ Mouse Anti-lin28a Antibody (CBMOAB-82765FYA)


Cat: CBMOAB-82765FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82765FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO82765FYA 100 µg
MO-AB-04865H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04865C 100 µg
MO-AB-08540W Monoclonal Cat (Felis catus) WB, ELISA MO08540W 100 µg
MO-AB-16044Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16044Y 100 µg
MO-AB-26802H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26802C 100 µg
MO-AB-37614W Monoclonal Goat (Capra hircus) WB, ELISA MO37614W 100 µg
MO-AB-58216W Monoclonal Marmoset WB, ELISA MO58216W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO82765FYA
SpecificityThis antibody binds to Zebrafish lin28a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism. Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets. 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Suppressor of microRNA (miRNA) biogenesis, including that of let-7. Binds specific target miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in their terminal loop, and recruits uridylyltransferase. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish lin28a Antibody is a mouse antibody against lin28a. It can be used for lin28a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein lin-28 homolog A; Lin-28A; lin28a; lin2
UniProt IDQ803L0
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MPPANPHLNHTGGCTKTEEEEAASSEEDSGSFHGSGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKPKGTQKRRSKGDRCFNCGGPNHHAKECQLPPQPKKCHFCQSISHMVANCPIKAQQLSPGSQGKSTTSTGEEEDMSHTPLLPESTD.
For Research Use Only | Not For Clinical Use.
Online Inquiry