AibGenesis™ Mouse Anti-lin28a Antibody (CBMOAB-82765FYA)
Cat: CBMOAB-82765FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-82765FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO82765FYA | 100 µg | ||
| MO-AB-04865H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04865C | 100 µg | ||
| MO-AB-08540W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08540W | 100 µg | ||
| MO-AB-16044Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16044Y | 100 µg | ||
| MO-AB-26802H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26802C | 100 µg | ||
| MO-AB-37614W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37614W | 100 µg | ||
| MO-AB-58216W | Monoclonal | Marmoset | WB, ELISA | MO58216W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO82765FYA |
| Specificity | This antibody binds to Zebrafish lin28a. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism. Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets. 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Suppressor of microRNA (miRNA) biogenesis, including that of let-7. Binds specific target miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in their terminal loop, and recruits uridylyltransferase. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins. Binds to and enhances the translation of mRNAs for several metabolic enzymes, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish lin28a Antibody is a mouse antibody against lin28a. It can be used for lin28a detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein lin-28 homolog A; Lin-28A; lin28a; lin2 |
| UniProt ID | Q803L0 |
| Protein Refseq | The length of the protein is 202 amino acids long. The sequence is show below: MPPANPHLNHTGGCTKTEEEEAASSEEDSGSFHGSGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKPKGTQKRRSKGDRCFNCGGPNHHAKECQLPPQPKKCHFCQSISHMVANCPIKAQQLSPGSQGKSTTSTGEEEDMSHTPLLPESTD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry