AibGenesis™ Mouse Anti-LIPN Antibody (CBMOAB-47010FYA)


Cat: CBMOAB-47010FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-47010FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO47010FYA 100 µg
MO-AB-20698W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20698W 100 µg
MO-AB-58234W Monoclonal Marmoset WB, ELISA MO58234W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO47010FYA
SpecificityThis antibody binds to Rhesus LIPN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LIPN Antibody is a mouse antibody against LIPN. It can be used for LIPN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLIPN
UniProt IDF6YQE6
Protein RefseqThe length of the protein is 368 amino acids long.
The sequence is show below: ISMMWLLLTTTCLICGTLNVGGFLDLENEVNPEVWMNTSEIIIYNGYPSEEYEVTTEDGYILLVNRIPYGRRHIRSTGPRPVVYMQHALFADNAYWLENYANGSLGFLLADAGYDVWMGNSRGNTWSRRHKTLSETDEKFWAFSFDEMAKYDLPGVIDFIVNKTGQEKLYFIGHSLGTTIGFVAFSTMPELAQRIKMNFALGPVISFKYPTGIFTSFFLLPNSIIKAVFGTKGFFLEDKKKKIPSTKICNNKILWLICSEFMSLWAGSNKKNMNQSRMDVYMSHAPTGSSIQNILHIKQLYQSDEFRAYDWGNEADNMKHYNQSHPPIYDLTAMKVPTAIWAGGHDVLVTPQDVARILPQIKSLHYFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry