AibGenesis™ Mouse Anti-LMAN2L Antibody (CBMOAB-47031FYA)


Cat: CBMOAB-47031FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-47031FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO47031FYA 100 µg
MO-AB-04122W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04122W 100 µg
MO-AB-04878H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04878C 100 µg
MO-AB-11155W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11155W 100 µg
MO-AB-14978R Monoclonal Cattle (Bos taurus) WB, ELISA MO14978R 100 µg
MO-AB-26820H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26820C 100 µg
MO-AB-58246W Monoclonal Marmoset WB, ELISA MO58246W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO47031FYA
SpecificityThis antibody binds to Rhesus LMAN2L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LMAN2L Antibody is a mouse antibody against LMAN2L. It can be used for LMAN2L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLMAN2L
UniProt IDF7D808
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MAATLGPLGWWQKWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry