Mouse Anti-LOH12CR1 Antibody (CBMOAB-49050FYA)


Cat: CBMOAB-49050FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49050FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO49050FYA 100 µg
CBMOAB-85229FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85229FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO49050FYA
SpecificityThis antibody binds to Rhesus LOH12CR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LOH12CR1 Antibody is a mouse antibody against LOH12CR1. It can be used for LOH12CR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOH12CR1
UniProt IDF6YFS9
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: MGSEQSSEAESRPNDLNSSGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGVDQTVPLLDRLNSLLPESERLEPFSMKPDRELRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry