AibGenesis™ Mouse Anti-lrrc10 Antibody (CBMOAB-85417FYA)


Cat: CBMOAB-85417FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85417FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO85417FYA 100 µg
MO-AB-04911H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04911C 100 µg
MO-AB-15057R Monoclonal Cattle (Bos taurus) WB, ELISA MO15057R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO85417FYA
SpecificityThis antibody binds to Zebrafish lrrc10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lrrc10 Antibody is a mouse antibody against lrrc10. It can be used for lrrc10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerdin1; lrrc1
UniProt IDQ5U8X4
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MGNVVRGAIAFVPSERCQRFLVGDLKEMPLDRTLDLSSRQLRRFPVRASAFDELVKLYLSDNHLSNLPLELRNLQKLQLLALDFNCFEELPLVICSLVQLNILYFGNNRLYSLPKELQQLTELKTLWLETNCFTSFPQVICELPNIKTLHLGYNQLRSLPAELGRLEELRSIWLAGNLLNDFPPVLLEMHYLEVMDVDRNRICQFPSLTHLRGLKLVIYDHNPCINAPVVAEGVRRVGRWADCSDDEEEEGDGKVANASAKAAVNTGSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry