Mouse Anti-LRRC18 Antibody (CBMOAB-49190FYA)


Cat: CBMOAB-49190FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49190FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset WB, ELISA MO49190FYA 100 µg
MO-AB-04912H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04912C 100 µg
MO-AB-15060R Monoclonal Cattle (Bos taurus) WB, ELISA MO15060R 100 µg
MO-AB-58354W Monoclonal Marmoset WB, ELISA MO58354W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset
CloneMO49190FYA
SpecificityThis antibody binds to Rhesus LRRC18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC18 Antibody is a mouse antibody against LRRC18. It can be used for LRRC18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRC18
UniProt IDF7DYN3
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MAKGEKGPKGKKITLKVAKNCIKITFDGKKRLDLSKMGITTFPKCILRLNDVDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPDESETFIDSIRRLENLYVVEEKDLCAACLRKCQNARDKLNRIKNMAMTTPRKTIFPNLISPNSMAKDSWEDWR.
For Research Use Only | Not For Clinical Use.
Online Inquiry